PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000756254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 64aa    MW: 7385.64 Da    PI: 9.3075
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000756254genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY56.65.1e-186422359
                   EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   sYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  MDP0000756254  6 SYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 42
                   9***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.44E-14543IPR003657WRKY domain
PROSITE profilePS5081115.135644IPR003657WRKY domain
SMARTSM007744.9E-8643IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.9E-15642IPR003657WRKY domain
PfamPF031064.8E-13642IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MILSGSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGIHN HPCEKLMETL TPLLKQMQFL  60
SRF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7089592e-52JF708959.1 Dimocarpus longan WRKY transcription factor 23-1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344897.11e-37PREDICTED: probable WRKY transcription factor 43
RefseqXP_010055075.12e-37PREDICTED: probable WRKY transcription factor 24 isoform X1
SwissprotQ8VWQ44e-33WRK56_ARATH; Probable WRKY transcription factor 56
SwissprotQ9FFS34e-33WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A059C0122e-37A0A059C012_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s08640.11e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.12e-34WRKY DNA-binding protein 24